Anti CIR1 pAb (ATL-HPA061442)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061442-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CIR1
Alternative Gene Name: CIR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041777: 59%, ENSRNOG00000018719: 56%
Entrez Gene ID: 9541
Uniprot ID: Q86X95
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SSESESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSD |
| Gene Sequence | SSESESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSD |
| Gene ID - Mouse | ENSMUSG00000041777 |
| Gene ID - Rat | ENSRNOG00000018719 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CIR1 pAb (ATL-HPA061442) | |
| Datasheet | Anti CIR1 pAb (ATL-HPA061442) Datasheet (External Link) |
| Vendor Page | Anti CIR1 pAb (ATL-HPA061442) at Atlas Antibodies |
| Documents & Links for Anti CIR1 pAb (ATL-HPA061442) | |
| Datasheet | Anti CIR1 pAb (ATL-HPA061442) Datasheet (External Link) |
| Vendor Page | Anti CIR1 pAb (ATL-HPA061442) |