Anti CIR1 pAb (ATL-HPA061442)

Atlas Antibodies

Catalog No.: ATL-HPA061442-25

Protein Description: corepressor interacting with RBPJ, 1
Gene Name: CIR1
Alternative Gene Name: CIR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041777: 59%, ENSRNOG00000018719: 56%
Entrez Gene ID: 9541
Uniprot ID: Q86X95
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSESESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSD
• Gene Sequence: SSESESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSD
• Gene ID - Mouse: ENSMUSG00000041777
• Gene ID - Rat: ENSRNOG00000018719
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.