Anti CIR1 pAb (ATL-HPA061442)

Atlas Antibodies

Catalog No.:
ATL-HPA061442-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: corepressor interacting with RBPJ, 1
Gene Name: CIR1
Alternative Gene Name: CIR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041777: 59%, ENSRNOG00000018719: 56%
Entrez Gene ID: 9541
Uniprot ID: Q86X95
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSESESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSD
Gene Sequence SSESESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSD
Gene ID - Mouse ENSMUSG00000041777
Gene ID - Rat ENSRNOG00000018719
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CIR1 pAb (ATL-HPA061442)
Datasheet Anti CIR1 pAb (ATL-HPA061442) Datasheet (External Link)
Vendor Page Anti CIR1 pAb (ATL-HPA061442) at Atlas Antibodies

Documents & Links for Anti CIR1 pAb (ATL-HPA061442)
Datasheet Anti CIR1 pAb (ATL-HPA061442) Datasheet (External Link)
Vendor Page Anti CIR1 pAb (ATL-HPA061442)