Anti CILP2 pAb (ATL-HPA041847)

Atlas Antibodies

SKU:
ATL-HPA041847-25
  • Immunohistochemical staining of human kidney shows moderate positivity in extracellular matrix in cells in tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cartilage intermediate layer protein 2
Gene Name: CILP2
Alternative Gene Name: MGC45771
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044006: 70%, ENSRNOG00000020622: 69%
Entrez Gene ID: 148113
Uniprot ID: Q8IUL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRFARILLGQEPIGFTAYQGDFTIEVPPSTQRLVVTFVDPSGEFMDAVRVLPFDPRGAGVYHEVKAMRKKAPVILHTSQSNTIPLGELEDEAPLGELVLPSGAFRRADGKPYSGP
Gene Sequence LRFARILLGQEPIGFTAYQGDFTIEVPPSTQRLVVTFVDPSGEFMDAVRVLPFDPRGAGVYHEVKAMRKKAPVILHTSQSNTIPLGELEDEAPLGELVLPSGAFRRADGKPYSGP
Gene ID - Mouse ENSMUSG00000044006
Gene ID - Rat ENSRNOG00000020622
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CILP2 pAb (ATL-HPA041847)
Datasheet Anti CILP2 pAb (ATL-HPA041847) Datasheet (External Link)
Vendor Page Anti CILP2 pAb (ATL-HPA041847) at Atlas Antibodies

Documents & Links for Anti CILP2 pAb (ATL-HPA041847)
Datasheet Anti CILP2 pAb (ATL-HPA041847) Datasheet (External Link)
Vendor Page Anti CILP2 pAb (ATL-HPA041847)