Anti CIDEC pAb (ATL-HPA018837)

Atlas Antibodies

Catalog No.: ATL-HPA018837-25

Protein Description: cell death-inducing DFFA-like effector c
Gene Name: CIDEC
Alternative Gene Name: CIDE-3, FLJ20871, Fsp27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030278: 81%, ENSRNOG00000009153: 83%
Entrez Gene ID: 63924
Uniprot ID: Q96AQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLK
• Gene Sequence: MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLK
• Gene ID - Mouse: ENSMUSG00000030278
• Gene ID - Rat: ENSRNOG00000009153
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.