Anti CIDEB pAb (ATL-HPA001272)

Atlas Antibodies

Catalog No.:
ATL-HPA001272-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cell death-inducing DFFA-like effector b
Gene Name: CIDEB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022219: 83%, ENSRNOG00000020377: 69%
Entrez Gene ID: 27141
Uniprot ID: Q9UHD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGV
Gene Sequence MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGV
Gene ID - Mouse ENSMUSG00000022219
Gene ID - Rat ENSRNOG00000020377
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CIDEB pAb (ATL-HPA001272)
Datasheet Anti CIDEB pAb (ATL-HPA001272) Datasheet (External Link)
Vendor Page Anti CIDEB pAb (ATL-HPA001272) at Atlas Antibodies

Documents & Links for Anti CIDEB pAb (ATL-HPA001272)
Datasheet Anti CIDEB pAb (ATL-HPA001272) Datasheet (External Link)
Vendor Page Anti CIDEB pAb (ATL-HPA001272)