Anti CIC pAb (ATL-HPA064725)

Atlas Antibodies

Catalog No.:
ATL-HPA064725-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: capicua transcriptional repressor
Gene Name: CIC
Alternative Gene Name: KIAA0306
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005442: 96%, ENSRNOG00000056118: 96%
Entrez Gene ID: 23152
Uniprot ID: Q96RK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MYSAHRPLMPASSAASRGLGMFVWTNVEPRSVAVFPWHSLVPFLAPSQPDPSVQPSEAQQPASHPVASNQSKEPAESAAVAHERP
Gene Sequence MYSAHRPLMPASSAASRGLGMFVWTNVEPRSVAVFPWHSLVPFLAPSQPDPSVQPSEAQQPASHPVASNQSKEPAESAAVAHERP
Gene ID - Mouse ENSMUSG00000005442
Gene ID - Rat ENSRNOG00000056118
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CIC pAb (ATL-HPA064725)
Datasheet Anti CIC pAb (ATL-HPA064725) Datasheet (External Link)
Vendor Page Anti CIC pAb (ATL-HPA064725) at Atlas Antibodies

Documents & Links for Anti CIC pAb (ATL-HPA064725)
Datasheet Anti CIC pAb (ATL-HPA064725) Datasheet (External Link)
Vendor Page Anti CIC pAb (ATL-HPA064725)