Anti CIC pAb (ATL-HPA044341 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA044341-25
  • Immunohistochemistry analysis in human testis and liver tissues using HPA044341 antibody. Corresponding CIC RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CIC antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: capicua transcriptional repressor
Gene Name: CIC
Alternative Gene Name: KIAA0306
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005442: 98%, ENSRNOG00000056118: 98%
Entrez Gene ID: 23152
Uniprot ID: Q96RK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKRKMRRRSSCSSEPNTPKSAKCEGDIFTFDRTGTEAEDVLGELEYDKVPYSSLRRTLDQRRALVMQLFQDHGFFPSAQATAAFQARYADIFPSKVCLQLKIREVRQKIMQA
Gene Sequence PKRKMRRRSSCSSEPNTPKSAKCEGDIFTFDRTGTEAEDVLGELEYDKVPYSSLRRTLDQRRALVMQLFQDHGFFPSAQATAAFQARYADIFPSKVCLQLKIREVRQKIMQA
Gene ID - Mouse ENSMUSG00000005442
Gene ID - Rat ENSRNOG00000056118
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CIC pAb (ATL-HPA044341 w/enhanced validation)
Datasheet Anti CIC pAb (ATL-HPA044341 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CIC pAb (ATL-HPA044341 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CIC pAb (ATL-HPA044341 w/enhanced validation)
Datasheet Anti CIC pAb (ATL-HPA044341 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CIC pAb (ATL-HPA044341 w/enhanced validation)