Anti CIB4 pAb (ATL-HPA036131)

Atlas Antibodies

SKU: ATL-HPA036131-25

• 

Protein Description: calcium and integrin binding family member 4
Gene Name: CIB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053194: 93%, ENSRNOG00000009898: 95%
Entrez Gene ID: 130106
Uniprot ID: A0PJX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPALRVNPFRDRICRVFSHKGMFSFEDVLGMASVFS
• Gene Sequence: GQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPALRVNPFRDRICRVFSHKGMFSFEDVLGMASVFS
• Gene ID - Mouse: ENSMUSG00000053194
• Gene ID - Rat: ENSRNOG00000009898
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.