Anti CIB4 pAb (ATL-HPA036131)

Atlas Antibodies

Catalog No.:
ATL-HPA036131-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcium and integrin binding family member 4
Gene Name: CIB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053194: 93%, ENSRNOG00000009898: 95%
Entrez Gene ID: 130106
Uniprot ID: A0PJX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPALRVNPFRDRICRVFSHKGMFSFEDVLGMASVFS
Gene Sequence GQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPALRVNPFRDRICRVFSHKGMFSFEDVLGMASVFS
Gene ID - Mouse ENSMUSG00000053194
Gene ID - Rat ENSRNOG00000009898
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CIB4 pAb (ATL-HPA036131)
Datasheet Anti CIB4 pAb (ATL-HPA036131) Datasheet (External Link)
Vendor Page Anti CIB4 pAb (ATL-HPA036131) at Atlas Antibodies

Documents & Links for Anti CIB4 pAb (ATL-HPA036131)
Datasheet Anti CIB4 pAb (ATL-HPA036131) Datasheet (External Link)
Vendor Page Anti CIB4 pAb (ATL-HPA036131)