Anti CIB4 pAb (ATL-HPA036130)
Atlas Antibodies
- SKU:
- ATL-HPA036130-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CIB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053194: 90%, ENSRNOG00000009898: 92%
Entrez Gene ID: 130106
Uniprot ID: A0PJX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHFWGC |
Gene Sequence | ACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHFWGC |
Gene ID - Mouse | ENSMUSG00000053194 |
Gene ID - Rat | ENSRNOG00000009898 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CIB4 pAb (ATL-HPA036130) | |
Datasheet | Anti CIB4 pAb (ATL-HPA036130) Datasheet (External Link) |
Vendor Page | Anti CIB4 pAb (ATL-HPA036130) at Atlas Antibodies |
Documents & Links for Anti CIB4 pAb (ATL-HPA036130) | |
Datasheet | Anti CIB4 pAb (ATL-HPA036130) Datasheet (External Link) |
Vendor Page | Anti CIB4 pAb (ATL-HPA036130) |