Anti CIB3 pAb (ATL-HPA043553)

Atlas Antibodies

Catalog No.:
ATL-HPA043553-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcium and integrin binding family member 3
Gene Name: CIB3
Alternative Gene Name: KIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074240: 90%, ENSRNOG00000014600: 83%
Entrez Gene ID: 117286
Uniprot ID: Q96Q77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FNNDDYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADG
Gene Sequence FNNDDYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADG
Gene ID - Mouse ENSMUSG00000074240
Gene ID - Rat ENSRNOG00000014600
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CIB3 pAb (ATL-HPA043553)
Datasheet Anti CIB3 pAb (ATL-HPA043553) Datasheet (External Link)
Vendor Page Anti CIB3 pAb (ATL-HPA043553) at Atlas Antibodies

Documents & Links for Anti CIB3 pAb (ATL-HPA043553)
Datasheet Anti CIB3 pAb (ATL-HPA043553) Datasheet (External Link)
Vendor Page Anti CIB3 pAb (ATL-HPA043553)