Anti CIB3 pAb (ATL-HPA043553)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043553-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CIB3
Alternative Gene Name: KIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074240: 90%, ENSRNOG00000014600: 83%
Entrez Gene ID: 117286
Uniprot ID: Q96Q77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FNNDDYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADG |
Gene Sequence | FNNDDYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADG |
Gene ID - Mouse | ENSMUSG00000074240 |
Gene ID - Rat | ENSRNOG00000014600 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CIB3 pAb (ATL-HPA043553) | |
Datasheet | Anti CIB3 pAb (ATL-HPA043553) Datasheet (External Link) |
Vendor Page | Anti CIB3 pAb (ATL-HPA043553) at Atlas Antibodies |
Documents & Links for Anti CIB3 pAb (ATL-HPA043553) | |
Datasheet | Anti CIB3 pAb (ATL-HPA043553) Datasheet (External Link) |
Vendor Page | Anti CIB3 pAb (ATL-HPA043553) |