Anti CIB2 pAb (ATL-HPA036697)

Atlas Antibodies

Catalog No.:
ATL-HPA036697-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcium and integrin binding family member 2
Gene Name: CIB2
Alternative Gene Name: DFNB48, KIP2, USH1J
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037493: 97%, ENSRNOG00000059834: 97%
Entrez Gene ID: 10518
Uniprot ID: O75838
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVD
Gene Sequence FNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVD
Gene ID - Mouse ENSMUSG00000037493
Gene ID - Rat ENSRNOG00000059834
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CIB2 pAb (ATL-HPA036697)
Datasheet Anti CIB2 pAb (ATL-HPA036697) Datasheet (External Link)
Vendor Page Anti CIB2 pAb (ATL-HPA036697) at Atlas Antibodies

Documents & Links for Anti CIB2 pAb (ATL-HPA036697)
Datasheet Anti CIB2 pAb (ATL-HPA036697) Datasheet (External Link)
Vendor Page Anti CIB2 pAb (ATL-HPA036697)