Anti CIB1 pAb (ATL-HPA048825)

Atlas Antibodies

Catalog No.:
ATL-HPA048825-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: calcium and integrin binding 1 (calmyrin)
Gene Name: CIB1
Alternative Gene Name: CALMYRIN, CIB, KIP, SIP2-28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030538: 98%, ENSRNOG00000033498: 99%
Entrez Gene ID: 10519
Uniprot ID: Q99828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSF
Gene Sequence DIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSF
Gene ID - Mouse ENSMUSG00000030538
Gene ID - Rat ENSRNOG00000033498
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CIB1 pAb (ATL-HPA048825)
Datasheet Anti CIB1 pAb (ATL-HPA048825) Datasheet (External Link)
Vendor Page Anti CIB1 pAb (ATL-HPA048825) at Atlas Antibodies

Documents & Links for Anti CIB1 pAb (ATL-HPA048825)
Datasheet Anti CIB1 pAb (ATL-HPA048825) Datasheet (External Link)
Vendor Page Anti CIB1 pAb (ATL-HPA048825)