Anti CIB1 pAb (ATL-HPA042413)

Atlas Antibodies

SKU: ATL-HPA042413-25

• 

Protein Description: calcium and integrin binding 1
Gene Name: CIB1
Alternative Gene Name: CIB, KIP, SIP2-28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030538: 89%, ENSRNOG00000033498: 88%
Entrez Gene ID: 10519
Uniprot ID: Q99828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD
• Gene Sequence: SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD
• Gene ID - Mouse: ENSMUSG00000030538
• Gene ID - Rat: ENSRNOG00000033498
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.