Anti CIB1 pAb (ATL-HPA042413)

Atlas Antibodies

Catalog No.:
ATL-HPA042413-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcium and integrin binding 1
Gene Name: CIB1
Alternative Gene Name: CIB, KIP, SIP2-28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030538: 89%, ENSRNOG00000033498: 88%
Entrez Gene ID: 10519
Uniprot ID: Q99828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD
Gene Sequence SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD
Gene ID - Mouse ENSMUSG00000030538
Gene ID - Rat ENSRNOG00000033498
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CIB1 pAb (ATL-HPA042413)
Datasheet Anti CIB1 pAb (ATL-HPA042413) Datasheet (External Link)
Vendor Page Anti CIB1 pAb (ATL-HPA042413) at Atlas Antibodies

Documents & Links for Anti CIB1 pAb (ATL-HPA042413)
Datasheet Anti CIB1 pAb (ATL-HPA042413) Datasheet (External Link)
Vendor Page Anti CIB1 pAb (ATL-HPA042413)