Anti CIB1 pAb (ATL-HPA042413)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042413-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CIB1
Alternative Gene Name: CIB, KIP, SIP2-28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030538: 89%, ENSRNOG00000033498: 88%
Entrez Gene ID: 10519
Uniprot ID: Q99828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD |
| Gene Sequence | SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD |
| Gene ID - Mouse | ENSMUSG00000030538 |
| Gene ID - Rat | ENSRNOG00000033498 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CIB1 pAb (ATL-HPA042413) | |
| Datasheet | Anti CIB1 pAb (ATL-HPA042413) Datasheet (External Link) |
| Vendor Page | Anti CIB1 pAb (ATL-HPA042413) at Atlas Antibodies |
| Documents & Links for Anti CIB1 pAb (ATL-HPA042413) | |
| Datasheet | Anti CIB1 pAb (ATL-HPA042413) Datasheet (External Link) |
| Vendor Page | Anti CIB1 pAb (ATL-HPA042413) |