Anti CIART pAb (ATL-HPA027515)

Atlas Antibodies

SKU: ATL-HPA027515-100

• 
• 

Protein Description: circadian associated repressor of transcription
Gene Name: CIART
Alternative Gene Name: BC017397, C1orf51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038550: 97%, ENSRNOG00000042717: 95%
Entrez Gene ID: 148523
Uniprot ID: Q8N365
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NTQGCTTEGDLLFAQKCKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPQ
• Gene Sequence: NTQGCTTEGDLLFAQKCKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPQ
• Gene ID - Mouse: ENSMUSG00000038550
• Gene ID - Rat: ENSRNOG00000042717
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.