Anti CHTF18 pAb (ATL-HPA056209)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056209-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CHTF18
Alternative Gene Name: C16orf41, C321D2.4, CHL12, Ctf18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019214: 88%, ENSRNOG00000019174: 90%
Entrez Gene ID: 63922
Uniprot ID: Q8WVB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQTKQL |
Gene Sequence | LLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQTKQL |
Gene ID - Mouse | ENSMUSG00000019214 |
Gene ID - Rat | ENSRNOG00000019174 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CHTF18 pAb (ATL-HPA056209) | |
Datasheet | Anti CHTF18 pAb (ATL-HPA056209) Datasheet (External Link) |
Vendor Page | Anti CHTF18 pAb (ATL-HPA056209) at Atlas Antibodies |
Documents & Links for Anti CHTF18 pAb (ATL-HPA056209) | |
Datasheet | Anti CHTF18 pAb (ATL-HPA056209) Datasheet (External Link) |
Vendor Page | Anti CHTF18 pAb (ATL-HPA056209) |