Anti CHTF18 pAb (ATL-HPA056209)

Atlas Antibodies

Catalog No.:
ATL-HPA056209-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome transmission fidelity factor 18
Gene Name: CHTF18
Alternative Gene Name: C16orf41, C321D2.4, CHL12, Ctf18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019214: 88%, ENSRNOG00000019174: 90%
Entrez Gene ID: 63922
Uniprot ID: Q8WVB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQTKQL
Gene Sequence LLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQTKQL
Gene ID - Mouse ENSMUSG00000019214
Gene ID - Rat ENSRNOG00000019174
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHTF18 pAb (ATL-HPA056209)
Datasheet Anti CHTF18 pAb (ATL-HPA056209) Datasheet (External Link)
Vendor Page Anti CHTF18 pAb (ATL-HPA056209) at Atlas Antibodies

Documents & Links for Anti CHTF18 pAb (ATL-HPA056209)
Datasheet Anti CHTF18 pAb (ATL-HPA056209) Datasheet (External Link)
Vendor Page Anti CHTF18 pAb (ATL-HPA056209)