Anti CHTF18 pAb (ATL-HPA056209)

Atlas Antibodies

Catalog No.: ATL-HPA056209-25

Protein Description: chromosome transmission fidelity factor 18
Gene Name: CHTF18
Alternative Gene Name: C16orf41, C321D2.4, CHL12, Ctf18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019214: 88%, ENSRNOG00000019174: 90%
Entrez Gene ID: 63922
Uniprot ID: Q8WVB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQTKQL
• Gene Sequence: LLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQTKQL
• Gene ID - Mouse: ENSMUSG00000019214
• Gene ID - Rat: ENSRNOG00000019174
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.