Anti CHSY3 pAb (ATL-HPA044612)

Atlas Antibodies

Catalog No.:
ATL-HPA044612-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chondroitin sulfate synthase 3
Gene Name: CHSY3
Alternative Gene Name: CHSY-2, CSS3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058152: 86%, ENSRNOG00000050152: 89%
Entrez Gene ID: 337876
Uniprot ID: Q70JA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFR
Gene Sequence LVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFR
Gene ID - Mouse ENSMUSG00000058152
Gene ID - Rat ENSRNOG00000050152
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHSY3 pAb (ATL-HPA044612)
Datasheet Anti CHSY3 pAb (ATL-HPA044612) Datasheet (External Link)
Vendor Page Anti CHSY3 pAb (ATL-HPA044612) at Atlas Antibodies

Documents & Links for Anti CHSY3 pAb (ATL-HPA044612)
Datasheet Anti CHSY3 pAb (ATL-HPA044612) Datasheet (External Link)
Vendor Page Anti CHSY3 pAb (ATL-HPA044612)