Anti CHSY1 pAb (ATL-HPA048902)

Atlas Antibodies

Catalog No.: ATL-HPA048902-25

Protein Description: chondroitin sulfate synthase 1
Gene Name: CHSY1
Alternative Gene Name: CSS1, KIAA0990
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032640: 93%, ENSRNOG00000012698: 93%
Entrez Gene ID: 22856
Uniprot ID: Q86X52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HEELDAQELAKRINQESGSLSFLSNSLKKLVPFQLPGSKSEHKEPKDKKINILIPLSGRFDMFVRFMGNFEKTC
• Gene Sequence: HEELDAQELAKRINQESGSLSFLSNSLKKLVPFQLPGSKSEHKEPKDKKINILIPLSGRFDMFVRFMGNFEKTC
• Gene ID - Mouse: ENSMUSG00000032640
• Gene ID - Rat: ENSRNOG00000012698
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.