Anti CHSY1 pAb (ATL-HPA048902)

Atlas Antibodies

SKU:
ATL-HPA048902-25
  • Immunohistochemical staining of human kidney shows strong membranous positivity in tubular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chondroitin sulfate synthase 1
Gene Name: CHSY1
Alternative Gene Name: CSS1, KIAA0990
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032640: 93%, ENSRNOG00000012698: 93%
Entrez Gene ID: 22856
Uniprot ID: Q86X52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HEELDAQELAKRINQESGSLSFLSNSLKKLVPFQLPGSKSEHKEPKDKKINILIPLSGRFDMFVRFMGNFEKTC
Gene Sequence HEELDAQELAKRINQESGSLSFLSNSLKKLVPFQLPGSKSEHKEPKDKKINILIPLSGRFDMFVRFMGNFEKTC
Gene ID - Mouse ENSMUSG00000032640
Gene ID - Rat ENSRNOG00000012698
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHSY1 pAb (ATL-HPA048902)
Datasheet Anti CHSY1 pAb (ATL-HPA048902) Datasheet (External Link)
Vendor Page Anti CHSY1 pAb (ATL-HPA048902) at Atlas Antibodies

Documents & Links for Anti CHSY1 pAb (ATL-HPA048902)
Datasheet Anti CHSY1 pAb (ATL-HPA048902) Datasheet (External Link)
Vendor Page Anti CHSY1 pAb (ATL-HPA048902)