Anti CHST8 pAb (ATL-HPA016004)

Atlas Antibodies

SKU: ATL-HPA016004-25

• 

Protein Description: carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8
Gene Name: CHST8
Alternative Gene Name: GALNAC-4-ST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060402: 60%, ENSRNOG00000022919: 59%
Entrez Gene ID: 64377
Uniprot ID: Q9H2A9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVPGIKFNIRPRQPHHDLPPGGSQDGDLKEPTERVTRDLSSGAPRGRNLPAPDQPQPPLQRGTRLRLRQRRRRLLIKKMPAAATIPANSSDAPFIRPGPGTLDGRWVSLHRSQQE
• Gene Sequence: QVPGIKFNIRPRQPHHDLPPGGSQDGDLKEPTERVTRDLSSGAPRGRNLPAPDQPQPPLQRGTRLRLRQRRRRLLIKKMPAAATIPANSSDAPFIRPGPGTLDGRWVSLHRSQQE
• Gene ID - Mouse: ENSMUSG00000060402
• Gene ID - Rat: ENSRNOG00000022919
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CHST8 pAb (ATL-HPA016004) – 4 Found

Fiete, Dorothy; Mi, Yiling; Beranek, Mary; Baenziger, Nancy L; Baenziger, Jacques U. The glycan-specific sulfotransferase (R77W)GalNAc-4-ST1 putatively responsible for peeling skin syndrome has normal properties consistent with a simple sequence polymorphisim. Glycobiology. 2017;27(5):450-456. 

Yang, Lixin; Yang, Yandong; Yuan, Jiamiao; Sun, Yan; Dai, Jiapei; Su, Bing. Transcriptomic Landscape of von Economo Neurons in Human Anterior Cingulate Cortex Revealed by Microdissected-Cell RNA Sequencing. Cerebral Cortex (New York, N.y. : 1991). 2019;29(2):838-851. 

Cabral, Rita M; Kurban, Mazen; Wajid, Muhammad; Shimomura, Yutaka; Petukhova, Lynn; Christiano, Angela M. Whole-exome sequencing in a single proband reveals a mutation in the CHST8 gene in autosomal recessive peeling skin syndrome. Genomics. 2012;99(4):202-8. 

Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54.