Anti CHST7 pAb (ATL-HPA003919)

Atlas Antibodies

Catalog No.:
ATL-HPA003919-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7
Gene Name: CHST7
Alternative Gene Name: C6ST-2, C6ST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037347: 92%, ENSRNOG00000004258: 92%
Entrez Gene ID: 56548
Uniprot ID: Q9NS84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PMWHLWQALYPGDAESLQGALRDMLRSLFRCDFSVLRLYAPPGDPAARAPDTANLTTAALFRWRTNKVICSPPLCPGAPRARAEVGLVEDTACERSCPPVAIRALEAECRKYPVVVIKDVRLLDLGVLVPLLRDPGLNLKVVQL
Gene Sequence PMWHLWQALYPGDAESLQGALRDMLRSLFRCDFSVLRLYAPPGDPAARAPDTANLTTAALFRWRTNKVICSPPLCPGAPRARAEVGLVEDTACERSCPPVAIRALEAECRKYPVVVIKDVRLLDLGVLVPLLRDPGLNLKVVQL
Gene ID - Mouse ENSMUSG00000037347
Gene ID - Rat ENSRNOG00000004258
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHST7 pAb (ATL-HPA003919)
Datasheet Anti CHST7 pAb (ATL-HPA003919) Datasheet (External Link)
Vendor Page Anti CHST7 pAb (ATL-HPA003919) at Atlas Antibodies

Documents & Links for Anti CHST7 pAb (ATL-HPA003919)
Datasheet Anti CHST7 pAb (ATL-HPA003919) Datasheet (External Link)
Vendor Page Anti CHST7 pAb (ATL-HPA003919)