Anti CHST5 pAb (ATL-HPA068029)

Atlas Antibodies

Catalog No.:
ATL-HPA068029-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: carbohydrate sulfotransferase 5
Gene Name: CHST5
Alternative Gene Name: FLJ22167, I-GLCNAC-6-ST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031952: 81%, ENSRNOG00000021521: 79%
Entrez Gene ID: 23563
Uniprot ID: Q9GZS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YRLVRFEDLAREPLAEIRALYAFTGLTLTPQLEAWIHNITHGS
Gene Sequence YRLVRFEDLAREPLAEIRALYAFTGLTLTPQLEAWIHNITHGS
Gene ID - Mouse ENSMUSG00000031952
Gene ID - Rat ENSRNOG00000021521
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHST5 pAb (ATL-HPA068029)
Datasheet Anti CHST5 pAb (ATL-HPA068029) Datasheet (External Link)
Vendor Page Anti CHST5 pAb (ATL-HPA068029) at Atlas Antibodies

Documents & Links for Anti CHST5 pAb (ATL-HPA068029)
Datasheet Anti CHST5 pAb (ATL-HPA068029) Datasheet (External Link)
Vendor Page Anti CHST5 pAb (ATL-HPA068029)