Anti CHST3 pAb (ATL-HPA047523)

Atlas Antibodies

SKU: ATL-HPA047523-25

• 
• 

Protein Description: carbohydrate (chondroitin 6) sulfotransferase 3
Gene Name: CHST3
Alternative Gene Name: C6ST, C6ST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057337: 84%, ENSRNOG00000000572: 86%
Entrez Gene ID: 9469
Uniprot ID: Q7LGC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRL
• Gene Sequence: IISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRL
• Gene ID - Mouse: ENSMUSG00000057337
• Gene ID - Rat: ENSRNOG00000000572
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.