Anti CHST3 pAb (ATL-HPA047523)

Atlas Antibodies

Catalog No.:
ATL-HPA047523-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: carbohydrate (chondroitin 6) sulfotransferase 3
Gene Name: CHST3
Alternative Gene Name: C6ST, C6ST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057337: 84%, ENSRNOG00000000572: 86%
Entrez Gene ID: 9469
Uniprot ID: Q7LGC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRL
Gene Sequence IISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRL
Gene ID - Mouse ENSMUSG00000057337
Gene ID - Rat ENSRNOG00000000572
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHST3 pAb (ATL-HPA047523)
Datasheet Anti CHST3 pAb (ATL-HPA047523) Datasheet (External Link)
Vendor Page Anti CHST3 pAb (ATL-HPA047523) at Atlas Antibodies

Documents & Links for Anti CHST3 pAb (ATL-HPA047523)
Datasheet Anti CHST3 pAb (ATL-HPA047523) Datasheet (External Link)
Vendor Page Anti CHST3 pAb (ATL-HPA047523)