Anti CHST15 pAb (ATL-HPA017584)

Atlas Antibodies

SKU:
ATL-HPA017584-25
  • Immunohistochemical staining of human heart muscle shows strong positivity in myocytes.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol & centrosome.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15
Gene Name: CHST15
Alternative Gene Name: BRAG, GALNAC4S-6ST, KIAA0598
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030930: 93%, ENSRNOG00000016267: 92%
Entrez Gene ID: 51363
Uniprot ID: Q7LFX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVER
Gene Sequence GIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVER
Gene ID - Mouse ENSMUSG00000030930
Gene ID - Rat ENSRNOG00000016267
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHST15 pAb (ATL-HPA017584)
Datasheet Anti CHST15 pAb (ATL-HPA017584) Datasheet (External Link)
Vendor Page Anti CHST15 pAb (ATL-HPA017584) at Atlas Antibodies

Documents & Links for Anti CHST15 pAb (ATL-HPA017584)
Datasheet Anti CHST15 pAb (ATL-HPA017584) Datasheet (External Link)
Vendor Page Anti CHST15 pAb (ATL-HPA017584)



Citations for Anti CHST15 pAb (ATL-HPA017584) – 2 Found
Buniello, Annalisa; Hardisty-Hughes, Rachel E; Pass, Johanna C; Bober, Eva; Smith, Richard J; Steel, Karen P. Headbobber: a combined morphogenetic and cochleosaccular mouse model to study 10qter deletions in human deafness. Plos One. 8(2):e56274.  PubMed
Matsuda, Yoko; Fujii, Yuko; Matsukawa, Miho; Ishiwata, Toshiyuki; Nishimura, Makoto; Arai, Tomio. Overexpression of carbohydrate sulfotransferase 15 in pancreatic cancer stroma is associated with worse prognosis. Oncology Letters. 2019;18(4):4100-4105.  PubMed