Anti CHST14 pAb (ATL-HPA071601)

Atlas Antibodies

SKU: ATL-HPA071601-25

• 
• 

Protein Description: carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14
Gene Name: CHST14
Alternative Gene Name: D4ST-1, D4ST1, HD4ST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074916: 81%, ENSRNOG00000045997: 78%
Entrez Gene ID:
Uniprot ID: Q8NCH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPV
• Gene Sequence: GILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPV
• Gene ID - Mouse: ENSMUSG00000074916
• Gene ID - Rat: ENSRNOG00000045997
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.