Anti CHST14 pAb (ATL-HPA071601)
Atlas Antibodies
- SKU:
- ATL-HPA071601-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CHST14
Alternative Gene Name: D4ST-1, D4ST1, HD4ST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074916: 81%, ENSRNOG00000045997: 78%
Entrez Gene ID:
Uniprot ID: Q8NCH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPV |
Gene Sequence | GILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPV |
Gene ID - Mouse | ENSMUSG00000074916 |
Gene ID - Rat | ENSRNOG00000045997 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CHST14 pAb (ATL-HPA071601) | |
Datasheet | Anti CHST14 pAb (ATL-HPA071601) Datasheet (External Link) |
Vendor Page | Anti CHST14 pAb (ATL-HPA071601) at Atlas Antibodies |
Documents & Links for Anti CHST14 pAb (ATL-HPA071601) | |
Datasheet | Anti CHST14 pAb (ATL-HPA071601) Datasheet (External Link) |
Vendor Page | Anti CHST14 pAb (ATL-HPA071601) |