Anti CHST14 pAb (ATL-HPA071601)

Atlas Antibodies

Catalog No.:
ATL-HPA071601-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14
Gene Name: CHST14
Alternative Gene Name: D4ST-1, D4ST1, HD4ST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074916: 81%, ENSRNOG00000045997: 78%
Entrez Gene ID:
Uniprot ID: Q8NCH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPV
Gene Sequence GILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPV
Gene ID - Mouse ENSMUSG00000074916
Gene ID - Rat ENSRNOG00000045997
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHST14 pAb (ATL-HPA071601)
Datasheet Anti CHST14 pAb (ATL-HPA071601) Datasheet (External Link)
Vendor Page Anti CHST14 pAb (ATL-HPA071601) at Atlas Antibodies

Documents & Links for Anti CHST14 pAb (ATL-HPA071601)
Datasheet Anti CHST14 pAb (ATL-HPA071601) Datasheet (External Link)
Vendor Page Anti CHST14 pAb (ATL-HPA071601)