Anti CHST13 pAb (ATL-HPA067960)

Atlas Antibodies

Catalog No.:
ATL-HPA067960-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: carbohydrate sulfotransferase 13
Gene Name: CHST13
Alternative Gene Name: C4ST3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056643: 77%, ENSRNOG00000025930: 73%
Entrez Gene ID: 166012
Uniprot ID: Q8NET6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCY
Gene Sequence GNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCY
Gene ID - Mouse ENSMUSG00000056643
Gene ID - Rat ENSRNOG00000025930
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHST13 pAb (ATL-HPA067960)
Datasheet Anti CHST13 pAb (ATL-HPA067960) Datasheet (External Link)
Vendor Page Anti CHST13 pAb (ATL-HPA067960) at Atlas Antibodies

Documents & Links for Anti CHST13 pAb (ATL-HPA067960)
Datasheet Anti CHST13 pAb (ATL-HPA067960) Datasheet (External Link)
Vendor Page Anti CHST13 pAb (ATL-HPA067960)