Anti CHST13 pAb (ATL-HPA067960)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067960-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CHST13
Alternative Gene Name: C4ST3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056643: 77%, ENSRNOG00000025930: 73%
Entrez Gene ID: 166012
Uniprot ID: Q8NET6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCY |
Gene Sequence | GNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCY |
Gene ID - Mouse | ENSMUSG00000056643 |
Gene ID - Rat | ENSRNOG00000025930 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CHST13 pAb (ATL-HPA067960) | |
Datasheet | Anti CHST13 pAb (ATL-HPA067960) Datasheet (External Link) |
Vendor Page | Anti CHST13 pAb (ATL-HPA067960) at Atlas Antibodies |
Documents & Links for Anti CHST13 pAb (ATL-HPA067960) | |
Datasheet | Anti CHST13 pAb (ATL-HPA067960) Datasheet (External Link) |
Vendor Page | Anti CHST13 pAb (ATL-HPA067960) |