Anti CHST12 pAb (ATL-HPA041680)

Atlas Antibodies

SKU:
ATL-HPA041680-25
  • Immunohistochemical staining of human adrenal gland shows strong nuclear positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: carbohydrate (chondroitin 4) sulfotransferase 12
Gene Name: CHST12
Alternative Gene Name: C4S-2, C4ST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036599: 92%, ENSRNOG00000001252: 92%
Entrez Gene ID: 55501
Uniprot ID: Q9NRB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGKLETLDEDAAQLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD
Gene Sequence VGKLETLDEDAAQLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD
Gene ID - Mouse ENSMUSG00000036599
Gene ID - Rat ENSRNOG00000001252
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHST12 pAb (ATL-HPA041680)
Datasheet Anti CHST12 pAb (ATL-HPA041680) Datasheet (External Link)
Vendor Page Anti CHST12 pAb (ATL-HPA041680) at Atlas Antibodies

Documents & Links for Anti CHST12 pAb (ATL-HPA041680)
Datasheet Anti CHST12 pAb (ATL-HPA041680) Datasheet (External Link)
Vendor Page Anti CHST12 pAb (ATL-HPA041680)