Anti CHST10 pAb (ATL-HPA012884)

Atlas Antibodies

SKU:
ATL-HPA012884-25
  • Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
  • Western blot analysis in human cell line NTERA-2.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: carbohydrate sulfotransferase 10
Gene Name: CHST10
Alternative Gene Name: HNK-1ST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026080: 83%, ENSRNOG00000012815: 81%
Entrez Gene ID: 9486
Uniprot ID: O43529
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEVRKLPEEKHIPEELKPTGKELPDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRL
Gene Sequence PEVRKLPEEKHIPEELKPTGKELPDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRL
Gene ID - Mouse ENSMUSG00000026080
Gene ID - Rat ENSRNOG00000012815
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHST10 pAb (ATL-HPA012884)
Datasheet Anti CHST10 pAb (ATL-HPA012884) Datasheet (External Link)
Vendor Page Anti CHST10 pAb (ATL-HPA012884) at Atlas Antibodies

Documents & Links for Anti CHST10 pAb (ATL-HPA012884)
Datasheet Anti CHST10 pAb (ATL-HPA012884) Datasheet (External Link)
Vendor Page Anti CHST10 pAb (ATL-HPA012884)