Anti CHRND pAb (ATL-HPA056404)

Atlas Antibodies

SKU:
ATL-HPA056404-25
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & plasma membrane.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cholinergic receptor nicotinic delta subunit
Gene Name: CHRND
Alternative Gene Name: ACHRD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026251: 91%, ENSRNOG00000019527: 90%
Entrez Gene ID: 1144
Uniprot ID: Q07001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVRRSSSLGYISKAEEYFLLKSRSDLMFEKQSERHGLARRLTTARRPPASSEQAQQELFNELKPAVDGANFIVNHMRDQNNYNEEKDSWNRV
Gene Sequence LVRRSSSLGYISKAEEYFLLKSRSDLMFEKQSERHGLARRLTTARRPPASSEQAQQELFNELKPAVDGANFIVNHMRDQNNYNEEKDSWNRV
Gene ID - Mouse ENSMUSG00000026251
Gene ID - Rat ENSRNOG00000019527
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHRND pAb (ATL-HPA056404)
Datasheet Anti CHRND pAb (ATL-HPA056404) Datasheet (External Link)
Vendor Page Anti CHRND pAb (ATL-HPA056404) at Atlas Antibodies

Documents & Links for Anti CHRND pAb (ATL-HPA056404)
Datasheet Anti CHRND pAb (ATL-HPA056404) Datasheet (External Link)
Vendor Page Anti CHRND pAb (ATL-HPA056404)