Anti CHRNB3 pAb (ATL-HPA045555)

Atlas Antibodies

Catalog No.:
ATL-HPA045555-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cholinergic receptor, nicotinic, beta 3 (neuronal)
Gene Name: CHRNB3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031492: 74%, ENSRNOG00000012448: 77%
Entrez Gene ID: 1142
Uniprot ID: Q05901
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTI
Gene Sequence TGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTI
Gene ID - Mouse ENSMUSG00000031492
Gene ID - Rat ENSRNOG00000012448
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHRNB3 pAb (ATL-HPA045555)
Datasheet Anti CHRNB3 pAb (ATL-HPA045555) Datasheet (External Link)
Vendor Page Anti CHRNB3 pAb (ATL-HPA045555) at Atlas Antibodies

Documents & Links for Anti CHRNB3 pAb (ATL-HPA045555)
Datasheet Anti CHRNB3 pAb (ATL-HPA045555) Datasheet (External Link)
Vendor Page Anti CHRNB3 pAb (ATL-HPA045555)