Anti CHRNA5 pAb (ATL-HPA054381)

Atlas Antibodies

Catalog No.:
ATL-HPA054381-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cholinergic receptor, nicotinic, alpha 5 (neuronal)
Gene Name: CHRNA5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035594: 74%, ENSRNOG00000013610: 74%
Entrez Gene ID: 1138
Uniprot ID: P30532
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDK
Gene Sequence AQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDK
Gene ID - Mouse ENSMUSG00000035594
Gene ID - Rat ENSRNOG00000013610
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHRNA5 pAb (ATL-HPA054381)
Datasheet Anti CHRNA5 pAb (ATL-HPA054381) Datasheet (External Link)
Vendor Page Anti CHRNA5 pAb (ATL-HPA054381) at Atlas Antibodies

Documents & Links for Anti CHRNA5 pAb (ATL-HPA054381)
Datasheet Anti CHRNA5 pAb (ATL-HPA054381) Datasheet (External Link)
Vendor Page Anti CHRNA5 pAb (ATL-HPA054381)