Anti CHRNA5 pAb (ATL-HPA054381)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054381-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CHRNA5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035594: 74%, ENSRNOG00000013610: 74%
Entrez Gene ID: 1138
Uniprot ID: P30532
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDK |
Gene Sequence | AQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDK |
Gene ID - Mouse | ENSMUSG00000035594 |
Gene ID - Rat | ENSRNOG00000013610 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CHRNA5 pAb (ATL-HPA054381) | |
Datasheet | Anti CHRNA5 pAb (ATL-HPA054381) Datasheet (External Link) |
Vendor Page | Anti CHRNA5 pAb (ATL-HPA054381) at Atlas Antibodies |
Documents & Links for Anti CHRNA5 pAb (ATL-HPA054381) | |
Datasheet | Anti CHRNA5 pAb (ATL-HPA054381) Datasheet (External Link) |
Vendor Page | Anti CHRNA5 pAb (ATL-HPA054381) |