Anti CHRM5 pAb (ATL-HPA013172)

Atlas Antibodies

Catalog No.:
ATL-HPA013172-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cholinergic receptor, muscarinic 5
Gene Name: CHRM5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074939: 86%, ENSRNOG00000006397: 86%
Entrez Gene ID: 1133
Uniprot ID: P08912
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRK
Gene Sequence AHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRK
Gene ID - Mouse ENSMUSG00000074939
Gene ID - Rat ENSRNOG00000006397
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHRM5 pAb (ATL-HPA013172)
Datasheet Anti CHRM5 pAb (ATL-HPA013172) Datasheet (External Link)
Vendor Page Anti CHRM5 pAb (ATL-HPA013172) at Atlas Antibodies

Documents & Links for Anti CHRM5 pAb (ATL-HPA013172)
Datasheet Anti CHRM5 pAb (ATL-HPA013172) Datasheet (External Link)
Vendor Page Anti CHRM5 pAb (ATL-HPA013172)
Citations for Anti CHRM5 pAb (ATL-HPA013172) – 1 Found
Molina, Judith; Rodriguez-Diaz, Rayner; Fachado, Alberto; Jacques-Silva, M Caroline; Berggren, Per-Olof; Caicedo, Alejandro. Control of insulin secretion by cholinergic signaling in the human pancreatic islet. Diabetes. 2014;63(8):2714-26.  PubMed