Anti CHRM3 pAb (ATL-HPA024106)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024106-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CHRM3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046159: 74%, ENSRNOG00000049410: 77%
Entrez Gene ID: 1131
Uniprot ID: P20309
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQV |
Gene Sequence | LHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQV |
Gene ID - Mouse | ENSMUSG00000046159 |
Gene ID - Rat | ENSRNOG00000049410 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CHRM3 pAb (ATL-HPA024106) | |
Datasheet | Anti CHRM3 pAb (ATL-HPA024106) Datasheet (External Link) |
Vendor Page | Anti CHRM3 pAb (ATL-HPA024106) at Atlas Antibodies |
Documents & Links for Anti CHRM3 pAb (ATL-HPA024106) | |
Datasheet | Anti CHRM3 pAb (ATL-HPA024106) Datasheet (External Link) |
Vendor Page | Anti CHRM3 pAb (ATL-HPA024106) |
Citations for Anti CHRM3 pAb (ATL-HPA024106) – 2 Found |
Molina, Judith; Rodriguez-Diaz, Rayner; Fachado, Alberto; Jacques-Silva, M Caroline; Berggren, Per-Olof; Caicedo, Alejandro. Control of insulin secretion by cholinergic signaling in the human pancreatic islet. Diabetes. 2014;63(8):2714-26. PubMed |
Hering, Nina A; Liu, Verena; Kim, Rayoung; Weixler, Benjamin; Droeser, Raoul A; Arndt, Marco; Pozios, Ioannis; Beyer, Katharina; Kreis, Martin E; Seeliger, Hendrik. Blockage of Cholinergic Signaling via Muscarinic Acetylcholine Receptor 3 Inhibits Tumor Growth in Human Colorectal Adenocarcinoma. Cancers. 2021;13(13) PubMed |