Anti CHRM3 pAb (ATL-HPA024106)

Atlas Antibodies

Catalog No.:
ATL-HPA024106-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cholinergic receptor, muscarinic 3
Gene Name: CHRM3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046159: 74%, ENSRNOG00000049410: 77%
Entrez Gene ID: 1131
Uniprot ID: P20309
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQV
Gene Sequence LHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQV
Gene ID - Mouse ENSMUSG00000046159
Gene ID - Rat ENSRNOG00000049410
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHRM3 pAb (ATL-HPA024106)
Datasheet Anti CHRM3 pAb (ATL-HPA024106) Datasheet (External Link)
Vendor Page Anti CHRM3 pAb (ATL-HPA024106) at Atlas Antibodies

Documents & Links for Anti CHRM3 pAb (ATL-HPA024106)
Datasheet Anti CHRM3 pAb (ATL-HPA024106) Datasheet (External Link)
Vendor Page Anti CHRM3 pAb (ATL-HPA024106)
Citations for Anti CHRM3 pAb (ATL-HPA024106) – 2 Found
Molina, Judith; Rodriguez-Diaz, Rayner; Fachado, Alberto; Jacques-Silva, M Caroline; Berggren, Per-Olof; Caicedo, Alejandro. Control of insulin secretion by cholinergic signaling in the human pancreatic islet. Diabetes. 2014;63(8):2714-26.  PubMed
Hering, Nina A; Liu, Verena; Kim, Rayoung; Weixler, Benjamin; Droeser, Raoul A; Arndt, Marco; Pozios, Ioannis; Beyer, Katharina; Kreis, Martin E; Seeliger, Hendrik. Blockage of Cholinergic Signaling via Muscarinic Acetylcholine Receptor 3 Inhibits Tumor Growth in Human Colorectal Adenocarcinoma. Cancers. 2021;13(13)  PubMed