Anti CHRDL2 pAb (ATL-HPA021771)

Atlas Antibodies

SKU:
ATL-HPA021771-25
  • Immunohistochemical staining of human kidney shows strong granular positivity in renal tubules.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chordin-like 2
Gene Name: CHRDL2
Alternative Gene Name: BNF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030732: 77%, ENSRNOG00000018394: 76%
Entrez Gene ID: 25884
Uniprot ID: Q6WN34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVLVHTSVSPSPDNLRRFALEHEASDLVEIYLWKLVKGIFHLTQIKKVRKQDFQKEAQHFRLLAGPHEGHWNVFLAQTLELKVTASPDKVTKT
Gene Sequence RVLVHTSVSPSPDNLRRFALEHEASDLVEIYLWKLVKGIFHLTQIKKVRKQDFQKEAQHFRLLAGPHEGHWNVFLAQTLELKVTASPDKVTKT
Gene ID - Mouse ENSMUSG00000030732
Gene ID - Rat ENSRNOG00000018394
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHRDL2 pAb (ATL-HPA021771)
Datasheet Anti CHRDL2 pAb (ATL-HPA021771) Datasheet (External Link)
Vendor Page Anti CHRDL2 pAb (ATL-HPA021771) at Atlas Antibodies

Documents & Links for Anti CHRDL2 pAb (ATL-HPA021771)
Datasheet Anti CHRDL2 pAb (ATL-HPA021771) Datasheet (External Link)
Vendor Page Anti CHRDL2 pAb (ATL-HPA021771)