Anti CHRDL1 pAb (ATL-HPA000250)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000250-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CHRDL1
Alternative Gene Name: CHL, MGC1, NRLN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031283: 96%, ENSRNOG00000004330: 94%
Entrez Gene ID: 91851
Uniprot ID: Q9BU40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DKKYRVGERWHPYLEPYGLVYCVNCICSENGNVLCSRVRCPNVHCLSPVHIPHLCCPRCPEDSLPPVNNKVTSKSCEYNGTTYQHGELFVAEGLFQNRQPNQCTQCSCSEGNVYC |
Gene Sequence | DKKYRVGERWHPYLEPYGLVYCVNCICSENGNVLCSRVRCPNVHCLSPVHIPHLCCPRCPEDSLPPVNNKVTSKSCEYNGTTYQHGELFVAEGLFQNRQPNQCTQCSCSEGNVYC |
Gene ID - Mouse | ENSMUSG00000031283 |
Gene ID - Rat | ENSRNOG00000004330 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CHRDL1 pAb (ATL-HPA000250) | |
Datasheet | Anti CHRDL1 pAb (ATL-HPA000250) Datasheet (External Link) |
Vendor Page | Anti CHRDL1 pAb (ATL-HPA000250) at Atlas Antibodies |
Documents & Links for Anti CHRDL1 pAb (ATL-HPA000250) | |
Datasheet | Anti CHRDL1 pAb (ATL-HPA000250) Datasheet (External Link) |
Vendor Page | Anti CHRDL1 pAb (ATL-HPA000250) |
Citations for Anti CHRDL1 pAb (ATL-HPA000250) – 1 Found |
Blanco-Suarez, Elena; Liu, Tong-Fei; Kopelevich, Alex; Allen, Nicola J. Astrocyte-Secreted Chordin-like 1 Drives Synapse Maturation and Limits Plasticity by Increasing Synaptic GluA2 AMPA Receptors. Neuron. 2018;100(5):1116-1132.e13. PubMed |