Anti CHRDL1 pAb (ATL-HPA000250)

Atlas Antibodies

SKU: ATL-HPA000250-25

• 

Protein Description: chordin-like 1
Gene Name: CHRDL1
Alternative Gene Name: CHL, MGC1, NRLN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031283: 96%, ENSRNOG00000004330: 94%
Entrez Gene ID: 91851
Uniprot ID: Q9BU40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKKYRVGERWHPYLEPYGLVYCVNCICSENGNVLCSRVRCPNVHCLSPVHIPHLCCPRCPEDSLPPVNNKVTSKSCEYNGTTYQHGELFVAEGLFQNRQPNQCTQCSCSEGNVYC
• Gene Sequence: DKKYRVGERWHPYLEPYGLVYCVNCICSENGNVLCSRVRCPNVHCLSPVHIPHLCCPRCPEDSLPPVNNKVTSKSCEYNGTTYQHGELFVAEGLFQNRQPNQCTQCSCSEGNVYC
• Gene ID - Mouse: ENSMUSG00000031283
• Gene ID - Rat: ENSRNOG00000004330
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CHRDL1 pAb (ATL-HPA000250) – 1 Found

Blanco-Suarez, Elena; Liu, Tong-Fei; Kopelevich, Alex; Allen, Nicola J. Astrocyte-Secreted Chordin-like 1 Drives Synapse Maturation and Limits Plasticity by Increasing Synaptic GluA2 AMPA Receptors. Neuron. 2018;100(5):1116-1132.e13.