Anti CHPF2 pAb (ATL-HPA020992)

Atlas Antibodies

SKU: ATL-HPA020992-25

• 
• 

Protein Description: chondroitin polymerizing factor 2
Gene Name: CHPF2
Alternative Gene Name: ChSy-3, CSGlcA-T, KIAA1402
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038181: 91%, ENSRNOG00000010466: 91%
Entrez Gene ID: 54480
Uniprot ID: Q9P2E5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSRATLST
• Gene Sequence: PCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSRATLST
• Gene ID - Mouse: ENSMUSG00000038181
• Gene ID - Rat: ENSRNOG00000010466
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.