Anti CHPF2 pAb (ATL-HPA020992)

Atlas Antibodies

Catalog No.:
ATL-HPA020992-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chondroitin polymerizing factor 2
Gene Name: CHPF2
Alternative Gene Name: ChSy-3, CSGlcA-T, KIAA1402
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038181: 91%, ENSRNOG00000010466: 91%
Entrez Gene ID: 54480
Uniprot ID: Q9P2E5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSRATLST
Gene Sequence PCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSRATLST
Gene ID - Mouse ENSMUSG00000038181
Gene ID - Rat ENSRNOG00000010466
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHPF2 pAb (ATL-HPA020992)
Datasheet Anti CHPF2 pAb (ATL-HPA020992) Datasheet (External Link)
Vendor Page Anti CHPF2 pAb (ATL-HPA020992) at Atlas Antibodies

Documents & Links for Anti CHPF2 pAb (ATL-HPA020992)
Datasheet Anti CHPF2 pAb (ATL-HPA020992) Datasheet (External Link)
Vendor Page Anti CHPF2 pAb (ATL-HPA020992)