Anti CHPF2 pAb (ATL-HPA020992)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020992-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CHPF2
Alternative Gene Name: ChSy-3, CSGlcA-T, KIAA1402
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038181: 91%, ENSRNOG00000010466: 91%
Entrez Gene ID: 54480
Uniprot ID: Q9P2E5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSRATLST |
Gene Sequence | PCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSRATLST |
Gene ID - Mouse | ENSMUSG00000038181 |
Gene ID - Rat | ENSRNOG00000010466 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CHPF2 pAb (ATL-HPA020992) | |
Datasheet | Anti CHPF2 pAb (ATL-HPA020992) Datasheet (External Link) |
Vendor Page | Anti CHPF2 pAb (ATL-HPA020992) at Atlas Antibodies |
Documents & Links for Anti CHPF2 pAb (ATL-HPA020992) | |
Datasheet | Anti CHPF2 pAb (ATL-HPA020992) Datasheet (External Link) |
Vendor Page | Anti CHPF2 pAb (ATL-HPA020992) |