Anti CHP1 pAb (ATL-HPA006616)

Atlas Antibodies

SKU:
ATL-HPA006616-25
  • Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: calcineurin-like EF-hand protein 1
Gene Name: CHP1
Alternative Gene Name: CHP, p22, p24, Sid470p, SLC9A1BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014077: 98%, ENSRNOG00000004742: 98%
Entrez Gene ID: 11261
Uniprot ID: Q99653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNIS
Gene Sequence GFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNIS
Gene ID - Mouse ENSMUSG00000014077
Gene ID - Rat ENSRNOG00000004742
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHP1 pAb (ATL-HPA006616)
Datasheet Anti CHP1 pAb (ATL-HPA006616) Datasheet (External Link)
Vendor Page Anti CHP1 pAb (ATL-HPA006616) at Atlas Antibodies

Documents & Links for Anti CHP1 pAb (ATL-HPA006616)
Datasheet Anti CHP1 pAb (ATL-HPA006616) Datasheet (External Link)
Vendor Page Anti CHP1 pAb (ATL-HPA006616)