Anti CHORDC1 pAb (ATL-HPA041040 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041040-25
  • Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
  • Western blot analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-CHORDC1 antibody. Corresponding CHORDC1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cysteine and histidine-rich domain (CHORD) containing 1
Gene Name: CHORDC1
Alternative Gene Name: CHP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001774: 99%, ENSRNOG00000026643: 99%
Entrez Gene ID: 26973
Uniprot ID: Q9UHD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAI
Gene Sequence LKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAI
Gene ID - Mouse ENSMUSG00000001774
Gene ID - Rat ENSRNOG00000026643
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CHORDC1 pAb (ATL-HPA041040 w/enhanced validation)
Datasheet Anti CHORDC1 pAb (ATL-HPA041040 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHORDC1 pAb (ATL-HPA041040 w/enhanced validation)



Citations for Anti CHORDC1 pAb (ATL-HPA041040 w/enhanced validation) – 2 Found
Fusella, Federica; Seclì, Laura; Busso, Elena; Krepelova, Anna; Moiso, Enrico; Rocca, Stefania; Conti, Laura; Annaratone, Laura; Rubinetto, Cristina; Mello-Grand, Maurizia; Singh, Vijay; Chiorino, Giovanna; Silengo, Lorenzo; Altruda, Fiorella; Turco, Emilia; Morotti, Alessandro; Oliviero, Salvatore; Castellano, Isabella; Cavallo, Federica; Provero, Paolo; Tarone, Guido; Brancaccio, Mara. The IKK/NF-κB signaling pathway requires Morgana to drive breast cancer metastasis. Nature Communications. 2017;8(1):1636.  PubMed
Haag, Andrea; Walser, Michael; Henggeler, Adrian; Hajnal, Alex. The CHORD protein CHP-1 regulates EGF receptor trafficking and signaling in C. elegans and in human cells. Elife. 2020;9( 32053105)  PubMed