Anti CHODL pAb (ATL-HPA057559)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057559-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CHODL
Alternative Gene Name: C21orf68, FLJ12627, MT75, PRED12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022860: 98%, ENSRNOG00000001915: 98%
Entrez Gene ID: 140578
Uniprot ID: Q9H9P2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQ |
Gene Sequence | FADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQ |
Gene ID - Mouse | ENSMUSG00000022860 |
Gene ID - Rat | ENSRNOG00000001915 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CHODL pAb (ATL-HPA057559) | |
Datasheet | Anti CHODL pAb (ATL-HPA057559) Datasheet (External Link) |
Vendor Page | Anti CHODL pAb (ATL-HPA057559) at Atlas Antibodies |
Documents & Links for Anti CHODL pAb (ATL-HPA057559) | |
Datasheet | Anti CHODL pAb (ATL-HPA057559) Datasheet (External Link) |
Vendor Page | Anti CHODL pAb (ATL-HPA057559) |