Anti CHODL pAb (ATL-HPA057559)

Atlas Antibodies

Catalog No.:
ATL-HPA057559-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chondrolectin
Gene Name: CHODL
Alternative Gene Name: C21orf68, FLJ12627, MT75, PRED12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022860: 98%, ENSRNOG00000001915: 98%
Entrez Gene ID: 140578
Uniprot ID: Q9H9P2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQ
Gene Sequence FADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQ
Gene ID - Mouse ENSMUSG00000022860
Gene ID - Rat ENSRNOG00000001915
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHODL pAb (ATL-HPA057559)
Datasheet Anti CHODL pAb (ATL-HPA057559) Datasheet (External Link)
Vendor Page Anti CHODL pAb (ATL-HPA057559) at Atlas Antibodies

Documents & Links for Anti CHODL pAb (ATL-HPA057559)
Datasheet Anti CHODL pAb (ATL-HPA057559) Datasheet (External Link)
Vendor Page Anti CHODL pAb (ATL-HPA057559)