Anti CHMP6 pAb (ATL-HPA023001 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023001-25

• 
• 

Protein Description: charged multivesicular body protein 6
Gene Name: CHMP6
Alternative Gene Name: FLJ11749, VPS20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025371: 95%, ENSRNOG00000004014: 95%
Entrez Gene ID: 79643
Uniprot ID: Q96FZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGNLFGCKKQSRVTEQDKAILQLKQQRDKLRQYQKRIAQQLERERALARQLLRDGRKERAKLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEMKV
• Gene Sequence: MGNLFGCKKQSRVTEQDKAILQLKQQRDKLRQYQKRIAQQLERERALARQLLRDGRKERAKLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEMKV
• Gene ID - Mouse: ENSMUSG00000025371
• Gene ID - Rat: ENSRNOG00000004014
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.