Anti CHMP5 pAb (ATL-HPA056437 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056437-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CHMP5
Alternative Gene Name: C9orf83, CGI-34, HSPC177, SNF7DC2, Vps60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028419: 96%, ENSRNOG00000008672: 96%
Entrez Gene ID: 51510
Uniprot ID: Q9NZZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELD |
| Gene Sequence | KAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELD |
| Gene ID - Mouse | ENSMUSG00000028419 |
| Gene ID - Rat | ENSRNOG00000008672 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHMP5 pAb (ATL-HPA056437 w/enhanced validation) | |
| Datasheet | Anti CHMP5 pAb (ATL-HPA056437 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CHMP5 pAb (ATL-HPA056437 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CHMP5 pAb (ATL-HPA056437 w/enhanced validation) | |
| Datasheet | Anti CHMP5 pAb (ATL-HPA056437 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CHMP5 pAb (ATL-HPA056437 w/enhanced validation) |