Anti CHMP4B pAb (ATL-HPA041401 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041401-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: charged multivesicular body protein 4B
Gene Name: CHMP4B
Alternative Gene Name: C20orf178, dJ553F4.4, Shax1, SNF7-2, VPS32B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038467: 100%, ENSRNOG00000046585: 100%
Entrez Gene ID: 128866
Uniprot ID: Q9H444
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK
Gene Sequence SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK
Gene ID - Mouse ENSMUSG00000038467
Gene ID - Rat ENSRNOG00000046585
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHMP4B pAb (ATL-HPA041401 w/enhanced validation)
Datasheet Anti CHMP4B pAb (ATL-HPA041401 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHMP4B pAb (ATL-HPA041401 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CHMP4B pAb (ATL-HPA041401 w/enhanced validation)
Datasheet Anti CHMP4B pAb (ATL-HPA041401 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHMP4B pAb (ATL-HPA041401 w/enhanced validation)
Citations for Anti CHMP4B pAb (ATL-HPA041401 w/enhanced validation) – 1 Found
Vila-Navarro, Elena; Fernandez-Castañer, Elena; Rovira-Rigau, Maria; Raimondi, Giulia; Vila-Casadesus, Maria; Lozano, Juan Jose; Soubeyran, Philippe; Iovanna, Juan; Castells, Antoni; Fillat, Cristina; Gironella, Meritxell. MiR-93 is related to poor prognosis in pancreatic cancer and promotes tumor progression by targeting microtubule dynamics. Oncogenesis. 2020;9(5):43.  PubMed