Anti CHMP3 pAb (ATL-HPA073383)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073383-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CHMP3
Alternative Gene Name: CGI-149, NEDF, VPS24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053119: 97%, ENSRNOG00000007356: 97%
Entrez Gene ID: 51652
Uniprot ID: Q9Y3E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKA |
| Gene Sequence | VNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKA |
| Gene ID - Mouse | ENSMUSG00000053119 |
| Gene ID - Rat | ENSRNOG00000007356 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHMP3 pAb (ATL-HPA073383) | |
| Datasheet | Anti CHMP3 pAb (ATL-HPA073383) Datasheet (External Link) |
| Vendor Page | Anti CHMP3 pAb (ATL-HPA073383) at Atlas Antibodies |
| Documents & Links for Anti CHMP3 pAb (ATL-HPA073383) | |
| Datasheet | Anti CHMP3 pAb (ATL-HPA073383) Datasheet (External Link) |
| Vendor Page | Anti CHMP3 pAb (ATL-HPA073383) |