Anti CHMP3 pAb (ATL-HPA073383)

Atlas Antibodies

SKU: ATL-HPA073383-25

• 
• 

Protein Description: charged multivesicular body protein 3
Gene Name: CHMP3
Alternative Gene Name: CGI-149, NEDF, VPS24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053119: 97%, ENSRNOG00000007356: 97%
Entrez Gene ID: 51652
Uniprot ID: Q9Y3E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKA
• Gene Sequence: VNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKA
• Gene ID - Mouse: ENSMUSG00000053119
• Gene ID - Rat: ENSRNOG00000007356
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.