Anti CHMP3 pAb (ATL-HPA015673 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA015673-25
![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414204)](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/83404/151854/atl-hpa015673_anti-chmp3-pab-atl-hpa015673-wenhanced-validation_33483__97050.1681101704.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414204)")
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CHMP3
Alternative Gene Name: CGI-149, NEDF, VPS24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053119: 94%, ENSRNOG00000007356: 95%
Entrez Gene ID: 51652
Uniprot ID: Q9Y3E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLR |
| Gene Sequence | AMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLR |
| Gene ID - Mouse | ENSMUSG00000053119 |
| Gene ID - Rat | ENSRNOG00000007356 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHMP3 pAb (ATL-HPA015673 w/enhanced validation) | |
| Datasheet | Anti CHMP3 pAb (ATL-HPA015673 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CHMP3 pAb (ATL-HPA015673 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CHMP3 pAb (ATL-HPA015673 w/enhanced validation) | |
| Datasheet | Anti CHMP3 pAb (ATL-HPA015673 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CHMP3 pAb (ATL-HPA015673 w/enhanced validation) |
| Citations for Anti CHMP3 pAb (ATL-HPA015673 w/enhanced validation) – 1 Found |
| Cera, Isabella; Whitton, Laura; Donohoe, Gary; Morris, Derek W; Dechant, Georg; Apostolova, Galina. Genes encoding SATB2-interacting proteins in adult cerebral cortex contribute to human cognitive ability. Plos Genetics. 2019;15(2):e1007890. PubMed |