Anti CHMP2B pAb (ATL-HPA035069)

Atlas Antibodies

SKU: ATL-HPA035069-25

• 

Protein Description: charged multivesicular body protein 2B
Gene Name: CHMP2B
Alternative Gene Name: CHMP2.5, DKFZP564O123, VPS2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004843: 99%, ENSRNOG00000040257: 99%
Entrez Gene ID: 25978
Uniprot ID: Q9UQN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKM
• Gene Sequence: MAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKM
• Gene ID - Mouse: ENSMUSG00000004843
• Gene ID - Rat: ENSRNOG00000040257
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CHMP2B pAb (ATL-HPA035069) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.