Anti CHMP2A pAb (ATL-HPA041153 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041153-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: charged multivesicular body protein 2A
Gene Name: CHMP2A
Alternative Gene Name: BC-2, CHMP2, VPS2, VPS2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033916: 100%, ENSRNOG00000043328: 100%
Entrez Gene ID: 27243
Uniprot ID: O43633
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAM
Gene Sequence NIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAM
Gene ID - Mouse ENSMUSG00000033916
Gene ID - Rat ENSRNOG00000043328
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHMP2A pAb (ATL-HPA041153 w/enhanced validation)
Datasheet Anti CHMP2A pAb (ATL-HPA041153 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHMP2A pAb (ATL-HPA041153 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CHMP2A pAb (ATL-HPA041153 w/enhanced validation)
Datasheet Anti CHMP2A pAb (ATL-HPA041153 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHMP2A pAb (ATL-HPA041153 w/enhanced validation)