Anti CHML pAb (ATL-HPA062967)

Atlas Antibodies

Catalog No.:
ATL-HPA062967-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: choroideremia-like (Rab escort protein 2)
Gene Name: CHML
Alternative Gene Name: REP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078185: 60%, ENSRNOG00000005733: 33%
Entrez Gene ID: 1122
Uniprot ID: P26374
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITY
Gene Sequence LEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITY
Gene ID - Mouse ENSMUSG00000078185
Gene ID - Rat ENSRNOG00000005733
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHML pAb (ATL-HPA062967)
Datasheet Anti CHML pAb (ATL-HPA062967) Datasheet (External Link)
Vendor Page Anti CHML pAb (ATL-HPA062967) at Atlas Antibodies

Documents & Links for Anti CHML pAb (ATL-HPA062967)
Datasheet Anti CHML pAb (ATL-HPA062967) Datasheet (External Link)
Vendor Page Anti CHML pAb (ATL-HPA062967)