Anti CHML pAb (ATL-HPA029628)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029628-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CHML
Alternative Gene Name: REP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078185: 48%, ENSRNOG00000000161: 39%
Entrez Gene ID: 1122
Uniprot ID: P26374
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLE |
| Gene Sequence | YASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLE |
| Gene ID - Mouse | ENSMUSG00000078185 |
| Gene ID - Rat | ENSRNOG00000000161 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CHML pAb (ATL-HPA029628) | |
| Datasheet | Anti CHML pAb (ATL-HPA029628) Datasheet (External Link) |
| Vendor Page | Anti CHML pAb (ATL-HPA029628) at Atlas Antibodies |
| Documents & Links for Anti CHML pAb (ATL-HPA029628) | |
| Datasheet | Anti CHML pAb (ATL-HPA029628) Datasheet (External Link) |
| Vendor Page | Anti CHML pAb (ATL-HPA029628) |
| Citations for Anti CHML pAb (ATL-HPA029628) – 1 Found |
| Chen, Tian-Wei; Yin, Fen-Fen; Yuan, Yan-Mei; Guan, Dong-Xian; Zhang, Erbin; Zhang, Feng-Kun; Jiang, Hao; Ma, Ning; Wang, Jing-Jing; Ni, Qian-Zhi; Qiu, Lin; Feng, Jing; Zhang, Xue-Li; Bao, Ying; Wang, Kang; Cheng, Shu-Qun; Wang, Xiao-Fan; Wang, Xiang; Li, Jing-Jing; Xie, Dong. CHML promotes liver cancer metastasis by facilitating Rab14 recycle. Nature Communications. 2019;10(1):2510. PubMed |