Anti CHML pAb (ATL-HPA029628)

Atlas Antibodies

Catalog No.:
ATL-HPA029628-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: choroideremia-like (Rab escort protein 2)
Gene Name: CHML
Alternative Gene Name: REP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078185: 48%, ENSRNOG00000000161: 39%
Entrez Gene ID: 1122
Uniprot ID: P26374
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLE
Gene Sequence YASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLE
Gene ID - Mouse ENSMUSG00000078185
Gene ID - Rat ENSRNOG00000000161
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHML pAb (ATL-HPA029628)
Datasheet Anti CHML pAb (ATL-HPA029628) Datasheet (External Link)
Vendor Page Anti CHML pAb (ATL-HPA029628) at Atlas Antibodies

Documents & Links for Anti CHML pAb (ATL-HPA029628)
Datasheet Anti CHML pAb (ATL-HPA029628) Datasheet (External Link)
Vendor Page Anti CHML pAb (ATL-HPA029628)
Citations for Anti CHML pAb (ATL-HPA029628) – 1 Found
Chen, Tian-Wei; Yin, Fen-Fen; Yuan, Yan-Mei; Guan, Dong-Xian; Zhang, Erbin; Zhang, Feng-Kun; Jiang, Hao; Ma, Ning; Wang, Jing-Jing; Ni, Qian-Zhi; Qiu, Lin; Feng, Jing; Zhang, Xue-Li; Bao, Ying; Wang, Kang; Cheng, Shu-Qun; Wang, Xiao-Fan; Wang, Xiang; Li, Jing-Jing; Xie, Dong. CHML promotes liver cancer metastasis by facilitating Rab14 recycle. Nature Communications. 2019;10(1):2510.  PubMed