Anti CHML pAb (ATL-HPA029627 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA029627-100
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleus & cytosol.
  • Western blot analysis using Anti-CHML antibody HPA029627 (A) shows similar pattern to independent antibody HPA029628 (B).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: choroideremia-like (Rab escort protein 2)
Gene Name: CHML
Alternative Gene Name: REP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078185: 70%, ENSRNOG00000000161: 38%
Entrez Gene ID: 1122
Uniprot ID: P26374
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITYSQIVKEGRRFNIDLVS
Gene Sequence VEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITYSQIVKEGRRFNIDLVS
Gene ID - Mouse ENSMUSG00000078185
Gene ID - Rat ENSRNOG00000000161
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHML pAb (ATL-HPA029627 w/enhanced validation)
Datasheet Anti CHML pAb (ATL-HPA029627 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHML pAb (ATL-HPA029627 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CHML pAb (ATL-HPA029627 w/enhanced validation)
Datasheet Anti CHML pAb (ATL-HPA029627 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CHML pAb (ATL-HPA029627 w/enhanced validation)