Anti CHKA pAb (ATL-HPA024153 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024153-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CHKA
Alternative Gene Name: CHK, CKI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024843: 86%, ENSRNOG00000016791: 88%
Entrez Gene ID: 1119
Uniprot ID: P35790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FDIGNHFCEWMYDYSYEKYPFFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLWGLWSIVQAKIS |
Gene Sequence | FDIGNHFCEWMYDYSYEKYPFFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLWGLWSIVQAKIS |
Gene ID - Mouse | ENSMUSG00000024843 |
Gene ID - Rat | ENSRNOG00000016791 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CHKA pAb (ATL-HPA024153 w/enhanced validation) | |
Datasheet | Anti CHKA pAb (ATL-HPA024153 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CHKA pAb (ATL-HPA024153 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CHKA pAb (ATL-HPA024153 w/enhanced validation) | |
Datasheet | Anti CHKA pAb (ATL-HPA024153 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CHKA pAb (ATL-HPA024153 w/enhanced validation) |
Citations for Anti CHKA pAb (ATL-HPA024153 w/enhanced validation) – 8 Found |
Hu, Liang; Wang, Ruo-Yu; Cai, Jian; Feng, Dan; Yang, Guang-Zhen; Xu, Qing-Guo; Zhai, Yan-Xia; Zhang, Yu; Zhou, Wei-Ping; Cai, Qing-Ping. Overexpression of CHKA contributes to tumor progression and metastasis and predicts poor prognosis in colorectal carcinoma. Oncotarget. 2016;7(41):66660-66678. PubMed |
Li, Yunqing; Inglese, Marianna; Dubash, Suraiya; Barnes, Chris; Brickute, Diana; Braga, Marta Costa; Wang, Ning; Beckley, Alice; Heinzmann, Kathrin; Allott, Louis; Lu, Haonan; Chen, Cen; Fu, Ruisi; Carroll, Laurence; Aboagye, Eric O. Consideration of Metabolite Efflux in Radiolabelled Choline Kinetics. Pharmaceutics. 2021;13(8) PubMed |
Trousil, Sebastian; Kaliszczak, Maciej; Schug, Zachary; Nguyen, Quang-De; Tomasi, Giampaolo; Favicchio, Rosy; Brickute, Diana; Fortt, Robin; Twyman, Frazer J; Carroll, Laurence; Kalusa, Andrew; Navaratnam, Naveenan; Adejumo, Thomas; Carling, David; Gottlieb, Eyal; Aboagye, Eric O. The novel choline kinase inhibitor ICL-CCIC-0019 reprograms cellular metabolism and inhibits cancer cell growth. Oncotarget. 2016;7(24):37103-37120. PubMed |
Wong Te Fong, Anne-Christine; Thavasu, Parames; Gagrica, Sladjana; Swales, Karen E; Leach, Martin O; Cosulich, Sabina C; Chung, Yuen-Li; Banerji, Udai. Evaluation of the combination of the dual m-TORC1/2 inhibitor vistusertib (AZD2014) and paclitaxel in ovarian cancer models. Oncotarget. 2017;8(69):113874-113884. PubMed |
Andrejeva, Gabriela; Gowan, Sharon; Lin, Gigin; Wong Te Fong, Anne-Christine Lf; Shamsaei, Elham; Parkes, Harry G; Mui, James; Raynaud, Florence I; Asad, Yasmin; Vizcay-Barrena, Gema; Nikitorowicz-Buniak, Joanna; Valenti, Melanie; Howell, Louise; Fleck, Roland A; Martin, Lesley-Ann; Kirkin, Vladimir; Leach, Martin O; Chung, Yuen-Li. De novo phosphatidylcholine synthesis is required for autophagosome membrane formation and maintenance during autophagy. Autophagy. 2020;16(6):1044-1060. PubMed |
Grech-Sollars, Matthew; Ordidge, Katherine L; Vaqas, Babar; Davies, Claire; Vaja, Vijay; Honeyfield, Lesley; Camp, Sophie; Towey, David; Mayers, Helen; Peterson, David; O'Neill, Kevin; Roncaroli, Federico; Barwick, Tara D; Waldman, Adam D. Imaging and Tissue Biomarkers of Choline Metabolism in Diffuse Adult Glioma: 18F-Fluoromethylcholine PET/CT, Magnetic Resonance Spectroscopy, and Choline Kinase α. Cancers. 2019;11(12) PubMed |
Dubash, Suraiya; Inglese, Marianna; Mauri, Francesco; Kozlowski, Kasia; Trivedi, Pritesh; Arshad, Mubarik; Challapalli, Amarnath; Barwick, Tara; Al-Nahhas, Adil; Stanbridge, Rex; Lewanski, Conrad; Berry, Matthew; Bowen, Frances; Aboagye, Eric O. Spatial heterogeneity of radiolabeled choline positron emission tomography in tumors of patients with non-small cell lung cancer: first-in-patient evaluation of [(18)F]fluoromethyl-(1,2-(2)H(4))-choline. Theranostics. 10(19):8677-8690. PubMed |
Wang, Ning; Brickute, Diana; Braga, Marta; Barnes, Chris; Lu, Haonan; Allott, Louis; Aboagye, Eric O. Novel Non-Congeneric Derivatives of the Choline Kinase Alpha Inhibitor ICL-CCIC-0019. Pharmaceutics. 2021;13(7) PubMed |