Anti CHIT1 pAb (ATL-HPA074844)

Atlas Antibodies

SKU:
ATL-HPA074844-25
  • Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chitinase 1
Gene Name: CHIT1
Alternative Gene Name: CHI3, CHIT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026450: 79%, ENSRNOG00000028072: 77%
Entrez Gene ID: 1118
Uniprot ID: Q13231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEK
Gene Sequence GSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEK
Gene ID - Mouse ENSMUSG00000026450
Gene ID - Rat ENSRNOG00000028072
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHIT1 pAb (ATL-HPA074844)
Datasheet Anti CHIT1 pAb (ATL-HPA074844) Datasheet (External Link)
Vendor Page Anti CHIT1 pAb (ATL-HPA074844) at Atlas Antibodies

Documents & Links for Anti CHIT1 pAb (ATL-HPA074844)
Datasheet Anti CHIT1 pAb (ATL-HPA074844) Datasheet (External Link)
Vendor Page Anti CHIT1 pAb (ATL-HPA074844)