Anti CHID1 pAb (ATL-HPA039374)

Atlas Antibodies

Catalog No.: ATL-HPA039374-100

Protein Description: chitinase domain containing 1
Gene Name: CHID1
Alternative Gene Name: FLJ42707, MGC3234
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025512: 87%, ENSRNOG00000050181: 90%
Entrez Gene ID: 66005
Uniprot ID: Q9BWS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPV
• Gene Sequence: KTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPV
• Gene ID - Mouse: ENSMUSG00000025512
• Gene ID - Rat: ENSRNOG00000050181
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.