Anti CHID1 pAb (ATL-HPA039374)

Atlas Antibodies

Catalog No.:
ATL-HPA039374-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: chitinase domain containing 1
Gene Name: CHID1
Alternative Gene Name: FLJ42707, MGC3234
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025512: 87%, ENSRNOG00000050181: 90%
Entrez Gene ID: 66005
Uniprot ID: Q9BWS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPV
Gene Sequence KTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPV
Gene ID - Mouse ENSMUSG00000025512
Gene ID - Rat ENSRNOG00000050181
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CHID1 pAb (ATL-HPA039374)
Datasheet Anti CHID1 pAb (ATL-HPA039374) Datasheet (External Link)
Vendor Page Anti CHID1 pAb (ATL-HPA039374) at Atlas Antibodies

Documents & Links for Anti CHID1 pAb (ATL-HPA039374)
Datasheet Anti CHID1 pAb (ATL-HPA039374) Datasheet (External Link)
Vendor Page Anti CHID1 pAb (ATL-HPA039374)