Anti CHID1 pAb (ATL-HPA039374)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039374-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: CHID1
Alternative Gene Name: FLJ42707, MGC3234
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025512: 87%, ENSRNOG00000050181: 90%
Entrez Gene ID: 66005
Uniprot ID: Q9BWS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPV |
Gene Sequence | KTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPV |
Gene ID - Mouse | ENSMUSG00000025512 |
Gene ID - Rat | ENSRNOG00000050181 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CHID1 pAb (ATL-HPA039374) | |
Datasheet | Anti CHID1 pAb (ATL-HPA039374) Datasheet (External Link) |
Vendor Page | Anti CHID1 pAb (ATL-HPA039374) at Atlas Antibodies |
Documents & Links for Anti CHID1 pAb (ATL-HPA039374) | |
Datasheet | Anti CHID1 pAb (ATL-HPA039374) Datasheet (External Link) |
Vendor Page | Anti CHID1 pAb (ATL-HPA039374) |