Anti CHIC2 pAb (ATL-HPA026784)

Atlas Antibodies

SKU:
ATL-HPA026784-25
  • Immunofluorescent staining of human cell line BJ shows localization to plasma membrane & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cysteine rich hydrophobic domain 2
Gene Name: CHIC2
Alternative Gene Name: BTL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029229: 99%, ENSRNOG00000002267: 99%
Entrez Gene ID: 26511
Uniprot ID: Q9UKJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVR
Gene Sequence DFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVR
Gene ID - Mouse ENSMUSG00000029229
Gene ID - Rat ENSRNOG00000002267
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHIC2 pAb (ATL-HPA026784)
Datasheet Anti CHIC2 pAb (ATL-HPA026784) Datasheet (External Link)
Vendor Page Anti CHIC2 pAb (ATL-HPA026784) at Atlas Antibodies

Documents & Links for Anti CHIC2 pAb (ATL-HPA026784)
Datasheet Anti CHIC2 pAb (ATL-HPA026784) Datasheet (External Link)
Vendor Page Anti CHIC2 pAb (ATL-HPA026784)